Lineage for d1hjda_ (1hjd A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536370Protein Melanoma inhibitory activity protein [63746] (1 species)
  7. 1536371Species Human (Homo sapiens) [TaxId:9606] [63747] (3 PDB entries)
  8. 1536375Domain d1hjda_: 1hjd A: [65846]

Details for d1hjda_

PDB Entry: 1hjd (more details)

PDB Description: melanoma inhibitory activity (mia) protein
PDB Compounds: (A:) human melanoma inhibitory activity protein

SCOPe Domain Sequences for d1hjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjda_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]}
adrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwggsvqg
dyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq

SCOPe Domain Coordinates for d1hjda_:

Click to download the PDB-style file with coordinates for d1hjda_.
(The format of our PDB-style files is described here.)

Timeline for d1hjda_: