Lineage for d1hj9a_ (1hj9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405567Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
    Uniprot P00760
  8. 2405573Domain d1hj9a_: 1hj9 A: [65845]
    complexed with anl, ca, gol, so4

Details for d1hj9a_

PDB Entry: 1hj9 (more details), 0.95 Å

PDB Description: atomic resolution structures of trypsin provide insight into structural radiation damage
PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1hj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcayglegkgdscqgdsggp
vvcsgklqgivswgsgcqaknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1hj9a_:

Click to download the PDB-style file with coordinates for d1hj9a_.
(The format of our PDB-style files is described here.)

Timeline for d1hj9a_: