Lineage for d1hj8a_ (1hj8 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 112135Protein Trypsin(ogen) [50515] (7 species)
  7. 112304Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (7 PDB entries)
  8. 112305Domain d1hj8a_: 1hj8 A: [65844]

Details for d1hj8a_

PDB Entry: 1hj8 (more details), 1 Å

PDB Description: 1.00 aa trypsin from atlantic salmon

SCOP Domain Sequences for d1hj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

SCOP Domain Coordinates for d1hj8a_:

Click to download the PDB-style file with coordinates for d1hj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hj8a_: