Lineage for d1hj8a_ (1hj8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056830Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)
  8. 2056831Domain d1hj8a_: 1hj8 A: [65844]
    complexed with bam, ca, so4

Details for d1hj8a_

PDB Entry: 1hj8 (more details), 1 Å

PDB Description: 1.00 aa trypsin from atlantic salmon
PDB Compounds: (A:) trypsin I

SCOPe Domain Sequences for d1hj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

SCOPe Domain Coordinates for d1hj8a_:

Click to download the PDB-style file with coordinates for d1hj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hj8a_: