Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry) |
Domain d1hixa_: 1hix A: [65839] |
PDB Entry: 1hix (more details), 2 Å
SCOPe Domain Sequences for d1hixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hixa_ b.29.1.11 (A:) Xylanase II {Streptomyces sp. s38, xyl1 [TaxId: 181109]} ittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvny sgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrvn apsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqssg sssis
Timeline for d1hixa_: