| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.202: Transcription factor NusA, N-terminal domain [69704] (1 superfamily) |
Superfamily d.202.1: Transcription factor NusA, N-terminal domain [69705] (1 family) ![]() |
| Family d.202.1.1: Transcription factor NusA, N-terminal domain [69706] (1 protein) |
| Protein Transcription factor NusA, N-terminal domain [69707] (2 species) |
| Species Thermotoga maritima [TaxId:243274] [69708] (1 PDB entry) |
| Domain d1hh2p4: 1hh2 P:1-126 [65838] Other proteins in same PDB: d1hh2p1, d1hh2p2, d1hh2p3 |
PDB Entry: 1hh2 (more details), 2.1 Å
SCOP Domain Sequences for d1hh2p4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh2p4 d.202.1.1 (P:1-126) Transcription factor NusA, N-terminal domain {Thermotoga maritima}
mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
lekekq
Timeline for d1hh2p4: