Lineage for d1hh2p4 (1hh2 P:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006144Fold d.202: Transcription factor NusA, N-terminal domain [69704] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha; bifurcated coiled beta-sheet
  4. 3006145Superfamily d.202.1: Transcription factor NusA, N-terminal domain [69705] (1 family) (S)
    automatically mapped to Pfam PF08529
  5. 3006146Family d.202.1.1: Transcription factor NusA, N-terminal domain [69706] (1 protein)
  6. 3006147Protein Transcription factor NusA, N-terminal domain [69707] (2 species)
  7. 3006151Species Thermotoga maritima [TaxId:2336] [69708] (2 PDB entries)
  8. 3006152Domain d1hh2p4: 1hh2 P:1-126 [65838]
    Other proteins in same PDB: d1hh2p1, d1hh2p2, d1hh2p3

Details for d1hh2p4

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima
PDB Compounds: (P:) n utilization substance protein a

SCOPe Domain Sequences for d1hh2p4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p4 d.202.1.1 (P:1-126) Transcription factor NusA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
lekekq

SCOPe Domain Coordinates for d1hh2p4:

Click to download the PDB-style file with coordinates for d1hh2p4.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p4: