| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
| Protein Transcription factor NusA, C-terminal domains [69701] (2 species) duplication: tandem repeat of two type II KH-domains |
| Species Thermotoga maritima [TaxId:2336] [69702] (2 PDB entries) |
| Domain d1hh2p3: 1hh2 P:277-344 [65837] Other proteins in same PDB: d1hh2p1, d1hh2p4 |
PDB Entry: 1hh2 (more details), 2.1 Å
SCOP Domain Sequences for d1hh2p3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl
Timeline for d1hh2p3: