SCOP 1.73: Domain d1hh2p1: 1hh2 P:127-198

Lineage for d1hh2p1 (1hh2 P:127-198)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein S1 domain of NusA [69265] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [69266] (2 PDB entries)

8. Domain d1hh2p1: 1hh2 P:127-198 [65835]
   Other proteins in same PDB: d1hh2p2, d1hh2p3, d1hh2p4

Details for d1hh2p1

PDB Entry: 1hh2, 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima

PDB Compounds: (P:) n utilization substance protein a

SCOP Domain Sequences for d1hh2p1:

Sequence; same for both SEQRES and ATOM records:

>d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]}
fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv
kttkgpkilvsr

Timeline for d1hh2p1:

• d1hh2p1 first appeared in SCOP 1.59
  
• d1hh2p1 appears in SCOP 1.71
  
• d1hh2p1 appears in SCOP 1.75
  
• d1hh2p1 appears in the current release, SCOPe 2.08