![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
![]() | Protein S1 domain of NusA [69265] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [69266] (2 PDB entries) |
![]() | Domain d1hh2p1: 1hh2 P:127-198 [65835] Other proteins in same PDB: d1hh2p2, d1hh2p3, d1hh2p4 |
PDB Entry: 1hh2 (more details), 2.1 Å
SCOP Domain Sequences for d1hh2p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv kttkgpkilvsr
Timeline for d1hh2p1: