Lineage for d1hh2p1 (1hh2 P:127-198)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383546Protein S1 domain of NusA [69265] (2 species)
  7. 2383553Species Thermotoga maritima [TaxId:2336] [69266] (2 PDB entries)
  8. 2383554Domain d1hh2p1: 1hh2 P:127-198 [65835]
    Other proteins in same PDB: d1hh2p2, d1hh2p3, d1hh2p4

Details for d1hh2p1

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima
PDB Compounds: (P:) n utilization substance protein a

SCOPe Domain Sequences for d1hh2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]}
fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv
kttkgpkilvsr

SCOPe Domain Coordinates for d1hh2p1:

Click to download the PDB-style file with coordinates for d1hh2p1.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p1: