Lineage for d1hgyb_ (1hgy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097507Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2097523Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries)
  8. 2097536Domain d1hgyb_: 1hgy B: [65834]
    complexed with bma, glc, man, nag; mutant

Details for d1hgyb_

PDB Entry: 1hgy (more details), 2.2 Å

PDB Description: cel6a d221a mutant
PDB Compounds: (B:) cellobiohydrolase cel6a (formerly called cbh II)

SCOPe Domain Sequences for d1hgyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgyb_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepaslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOPe Domain Coordinates for d1hgyb_:

Click to download the PDB-style file with coordinates for d1hgyb_.
(The format of our PDB-style files is described here.)

Timeline for d1hgyb_: