Lineage for d1hgwa_ (1hgw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110413Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2110414Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2110430Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries)
  8. 2110437Domain d1hgwa_: 1hgw A: [65831]
    complexed with co, man, nag; mutant

Details for d1hgwa_

PDB Entry: 1hgw (more details), 2.1 Å

PDB Description: cel6a d175a mutant
PDB Compounds: (A:) cellobiohydrolase cel6a (formerly called cbh II)

SCOPe Domain Sequences for d1hgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdracaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOPe Domain Coordinates for d1hgwa_:

Click to download the PDB-style file with coordinates for d1hgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1hgwa_: