Lineage for d1hg8a_ (1hg8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069234Family b.80.1.3: Galacturonase [51137] (3 protein domains)
  6. 2069235Protein Polygalacturonase [51140] (6 species)
  7. 2069256Species Fusarium moniliforme [TaxId:117187] [69332] (1 PDB entry)
  8. 2069257Domain d1hg8a_: 1hg8 A: [65830]
    complexed with nag

Details for d1hg8a_

PDB Entry: 1hg8 (more details), 1.73 Å

PDB Description: Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme
PDB Compounds: (A:) endopolygalacturonase

SCOPe Domain Sequences for d1hg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]}
dpcsvteysglatavsscknivlngfqvptgkqldlsslqndstvtfkgtttfattadnd
fnpivisgsnititgasghvidgngqaywdgkgsnsnsnqkpdhfivvqkttgnskitnl
niqnwpvhcfditgssqltisglildnragdkpnaksgslpaahntdgfdisssdhvtld
nnhvynqddcvavtsgtnivvsnmycsgghglsigsvggksdnvvdgvqflssqvvnsqn
gcriksnsgatgtinnvtyqnialtnistygvdvqqdylnggptgkptngvkisnikfik
vtgtvassaqdwfilcgdgscsgftfsgnaitgggktsscnyptntcps

SCOPe Domain Coordinates for d1hg8a_:

Click to download the PDB-style file with coordinates for d1hg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hg8a_: