Lineage for d1hfua3 (1hfu A:304-503)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224695Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 224730Protein Laccase [49557] (4 species)
    consists of three domains of this fold
  7. 224731Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)
  8. 224734Domain d1hfua3: 1hfu A:304-503 [65829]
    complexed with cu, man, nag

Details for d1hfua3

PDB Entry: 1hfu (more details), 1.68 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution

SCOP Domain Sequences for d1hfua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus)}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtv

SCOP Domain Coordinates for d1hfua3:

Click to download the PDB-style file with coordinates for d1hfua3.
(The format of our PDB-style files is described here.)

Timeline for d1hfua3: