Lineage for d1hfua2 (1hfu A:132-303)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106913Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 106948Protein Laccase [49557] (1 species)
  7. 106949Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)
  8. 106951Domain d1hfua2: 1hfu A:132-303 [65828]

Details for d1hfua2

PDB Entry: 1hfu (more details), 1.68 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1hfua2:

Sequence, based on SEQRES records: (download)

>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus)}
phaalydeddentiitladwyhipapsiqgaaqpdatlingkgryvggpaaelsivnveq
gkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftgqrysfvldanq
pvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnpaql

Sequence, based on observed residues (ATOM records): (download)

>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus)}
phaalydeddentiitladwyhipapsiqqpdatlingkgryvggpaaelsivnveqgkk
yrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftgqrysfvldanqpvd
nywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnpaql

SCOP Domain Coordinates for d1hfua2:

Click to download the PDB-style file with coordinates for d1hfua2.
(The format of our PDB-style files is described here.)

Timeline for d1hfua2: