Lineage for d1hf6a_ (1hf6 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816006Protein Endoglucanase Cel5a [51499] (4 species)
  7. 816007Species Bacillus agaradhaerens [TaxId:76935] [51500] (20 PDB entries)
    Uniprot O85465 30-329
  8. 816014Domain d1hf6a_: 1hf6 A: [65825]
    complexed with acy, ct3, gol, so4

Details for d1hf6a_

PDB Entry: 1hf6 (more details), 1.15 Å

PDB Description: endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
PDB Compounds: (A:) endoglucanase b

SCOP Domain Sequences for d1hf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf6a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d1hf6a_:

Click to download the PDB-style file with coordinates for d1hf6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hf6a_: