Lineage for d1hf5a_ (1hf5 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116680Protein Endoglucanase Cel5a [51499] (2 species)
  7. 116681Species Bacillus agaradhaerens [TaxId:76935] [51500] (15 PDB entries)
  8. 116684Domain d1hf5a_: 1hf5 A: [65824]

Details for d1hf5a_

PDB Entry: 1hf5 (more details), 1.1 Å

PDB Description: 2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution

SCOP Domain Sequences for d1hf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf5a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d1hf5a_:

Click to download the PDB-style file with coordinates for d1hf5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hf5a_:

  • d1hf5a_ is new in SCOP 1.59
  • d1hf5a_ does not appear in SCOP 1.61