Lineage for d1hf0b2 (1hf0 B:6-75)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322503Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 2322508Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 2322509Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 2322513Domain d1hf0b2: 1hf0 B:6-75 [65823]
    Other proteins in same PDB: d1hf0a1, d1hf0b1

Details for d1hf0b2

PDB Entry: 1hf0 (more details), 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
PDB Compounds: (B:) octamer-binding transcription factor 1

SCOPe Domain Sequences for d1hf0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf0b2 a.35.1.1 (B:6-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
llekwlndae

SCOPe Domain Coordinates for d1hf0b2:

Click to download the PDB-style file with coordinates for d1hf0b2.
(The format of our PDB-style files is described here.)

Timeline for d1hf0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hf0b1