SCOP 1.71: Domain d1hf0b2: 1hf0 B:6-75

Lineage for d1hf0b2 (1hf0 B:6-75)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1hf0b2: 1hf0 B:6-75 [65823]
   Other proteins in same PDB: d1hf0a1, d1hf0b1
   mutant

Details for d1hf0b2

PDB Entry: 1hf0, 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer

SCOP Domain Sequences for d1hf0b2:

Sequence; same for both SEQRES and ATOM records:

>d1hf0b2 a.35.1.1 (B:6-75) Oct-1 {Human (Homo sapiens)}
leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
llekwlndae

Timeline for d1hf0b2:

• d1hf0b2 first appeared in SCOP 1.59
  
• d1hf0b2 appears in SCOP 1.69
  
• d1hf0b2 appears in SCOP 1.73
  
• d1hf0b2 appears in the current release, SCOPe 2.08