Lineage for d1hf0b1 (1hf0 B:102-159)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351238Family a.4.1.1: Homeodomain [46690] (22 proteins)
  6. 351319Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 351320Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 351324Domain d1hf0b1: 1hf0 B:102-159 [65822]
    Other proteins in same PDB: d1hf0a2, d1hf0b2
    mutant

Details for d1hf0b1

PDB Entry: 1hf0 (more details), 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer

SCOP Domain Sequences for d1hf0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf0b1 a.4.1.1 (B:102-159) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqkekri

SCOP Domain Coordinates for d1hf0b1:

Click to download the PDB-style file with coordinates for d1hf0b1.
(The format of our PDB-style files is described here.)

Timeline for d1hf0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hf0b2