![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (12 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (22 proteins) |
![]() | Protein Oct-1 POU Homeodomain [46699] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries) |
![]() | Domain d1hf0b1: 1hf0 B:102-159 [65822] Other proteins in same PDB: d1hf0a2, d1hf0b2 mutant |
PDB Entry: 1hf0 (more details), 2.7 Å
SCOP Domain Sequences for d1hf0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hf0b1 a.4.1.1 (B:102-159) Oct-1 POU Homeodomain {Human (Homo sapiens)} rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqkekri
Timeline for d1hf0b1: