SCOPe 2.08: Domain d1hf0b1: 1hf0 B:102-159

Lineage for d1hf0b1 (1hf0 B:102-159)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1hf0b1: 1hf0 B:102-159 [65822]
   Other proteins in same PDB: d1hf0a2, d1hf0b2

Details for d1hf0b1

PDB Entry: 1hf0, 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer

PDB Compounds: (B:) octamer-binding transcription factor 1

SCOPe Domain Sequences for d1hf0b1:

Sequence; same for both SEQRES and ATOM records:

>d1hf0b1 a.4.1.1 (B:102-159) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqkekri

Timeline for d1hf0b1:

• d1hf0b1 first appeared in SCOP 1.59
  
• d1hf0b1 appears in SCOPe 2.07