Lineage for d1hf0a2 (1hf0 A:6-75)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280586Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 280587Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 280588Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 280593Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 280594Species Human (Homo sapiens) [TaxId:9606] [47416] (6 PDB entries)
  8. 280597Domain d1hf0a2: 1hf0 A:6-75 [65821]
    Other proteins in same PDB: d1hf0a1, d1hf0b1

Details for d1hf0a2

PDB Entry: 1hf0 (more details), 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer

SCOP Domain Sequences for d1hf0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf0a2 a.35.1.1 (A:6-75) Oct-1 {Human (Homo sapiens)}
leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
llekwlndae

SCOP Domain Coordinates for d1hf0a2:

Click to download the PDB-style file with coordinates for d1hf0a2.
(The format of our PDB-style files is described here.)

Timeline for d1hf0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hf0a1