Lineage for d1hf0a2 (1hf0 A:6-75)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97149Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 97150Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 97151Family a.35.1.1: POU-specific domain [47414] (2 proteins)
  6. 97152Protein Oct-1 [47415] (1 species)
  7. 97153Species Human (Homo sapiens) [TaxId:9606] [47416] (5 PDB entries)
  8. 97155Domain d1hf0a2: 1hf0 A:6-75 [65821]
    Other proteins in same PDB: d1hf0a1, d1hf0b1

Details for d1hf0a2

PDB Entry: 1hf0 (more details), 2.7 Å

PDB Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer

SCOP Domain Sequences for d1hf0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf0a2 a.35.1.1 (A:6-75) Oct-1 {Human (Homo sapiens)}
leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
llekwlndae

SCOP Domain Coordinates for d1hf0a2:

Click to download the PDB-style file with coordinates for d1hf0a2.
(The format of our PDB-style files is described here.)

Timeline for d1hf0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hf0a1