SCOP 1.71: Domain d1heee_: 1hee E:

Lineage for d1heee_ (1hee E:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)

8. Domain d1heee_: 1hee E: [65817]
   complexed with lhy, zn

Details for d1heee_

PDB Entry: 1hee, 1.75 Å

PDB Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with l-n-hydroxyaminocarbonyl phenylalanine at 2.3 a

SCOP Domain Sequences for d1heee_:

Sequence; same for both SEQRES and ATOM records:

>d1heee_ c.56.5.1 (E:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d1heee_:

• d1heee_ first appeared in SCOP 1.59
  
• d1heee_ appears in SCOP 1.69
  
• d1heee_ appears in SCOP 1.73
  
• d1heee_ appears in the current release, SCOPe 2.08