Lineage for d1heee_ (1hee E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398390Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 398391Protein Carboxypeptidase A [53189] (4 species)
  7. 398394Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)
  8. 398414Domain d1heee_: 1hee E: [65817]
    complexed with lhy, zn

Details for d1heee_

PDB Entry: 1hee (more details), 1.75 Å

PDB Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with l-n-hydroxyaminocarbonyl phenylalanine at 2.3 a

SCOP Domain Sequences for d1heee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heee_ c.56.5.1 (E:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d1heee_:

Click to download the PDB-style file with coordinates for d1heee_.
(The format of our PDB-style files is described here.)

Timeline for d1heee_: