Lineage for d1hdue_ (1hdu E:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53190] (20 PDB entries) 
Domain d1hdue_: 1hdu E: [65813]
Details for d1hdue_
PDB Entry: 1hdu (more details), 1.75 Å
PDB Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with aminocarbonylphenylalanine at 1.75 a
SCOP Domain Sequences for d1hdue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdue_ c.56.5.1 (E:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn
SCOP Domain Coordinates for d1hdue_:
Click to download the PDB-style file with coordinates for d1hdue_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hdue_:
- d1hdue_ is new in SCOP 1.59
- d1hdue_ appears in SCOP 1.61
- d1hdue_ appears in the current release, SCOPe 2.08
View in 3D
