Lineage for d1hdqa_ (1hdq A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182572Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 182719Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 182720Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 182721Protein Carboxypeptidase A [53189] (4 species)
  7. 182724Species Cow (Bos taurus) [TaxId:9913] [53190] (23 PDB entries)
  8. 182748Domain d1hdqa_: 1hdq A: [65809]

Details for d1hdqa_

PDB Entry: 1hdq (more details), 2.3 Å

PDB Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with d-n-hydroxyaminocarbonyl phenylalanine at 2.3 a

SCOP Domain Sequences for d1hdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdqa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtlnn

SCOP Domain Coordinates for d1hdqa_:

Click to download the PDB-style file with coordinates for d1hdqa_.
(The format of our PDB-style files is described here.)

Timeline for d1hdqa_: