![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.2: Serine proteinase inhibitor lekti [69960] (1 protein) |
![]() | Protein Serine proteinase inhibitor lekti [69961] (1 species) kazal-type 5 serine protease inhibitor; consists of several similar domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69962] (3 PDB entries) Uniprot Q9NQ38 28-77 |
![]() | Domain d1hdla_: 1hdl A: [65808] domain 1 |
PDB Entry: 1hdl (more details)
SCOPe Domain Sequences for d1hdla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} knedqemchefqafmkngklfcpqdkkffqsldgimfinkcatckmilekeaksq
Timeline for d1hdla_: