Lineage for d1hdla_ (1hdl A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038549Family g.68.1.2: Serine proteinase inhibitor lekti [69960] (1 protein)
  6. 3038550Protein Serine proteinase inhibitor lekti [69961] (1 species)
    kazal-type 5 serine protease inhibitor; consists of several similar domains
  7. 3038551Species Human (Homo sapiens) [TaxId:9606] [69962] (3 PDB entries)
    Uniprot Q9NQ38 28-77
  8. 3038553Domain d1hdla_: 1hdl A: [65808]
    domain 1

Details for d1hdla_

PDB Entry: 1hdl (more details)

PDB Description: lekti domain one
PDB Compounds: (A:) serine proteinase inhibitor lekti

SCOPe Domain Sequences for d1hdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]}
knedqemchefqafmkngklfcpqdkkffqsldgimfinkcatckmilekeaksq

SCOPe Domain Coordinates for d1hdla_:

Click to download the PDB-style file with coordinates for d1hdla_.
(The format of our PDB-style files is described here.)

Timeline for d1hdla_: