Lineage for d1hdka_ (1hdk A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371566Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 371567Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)
  7. 371568Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries)
  8. 371571Domain d1hdka_: 1hdk A: [65807]
    complexed with pmb

Details for d1hdka_

PDB Entry: 1hdk (more details), 1.8 Å

PDB Description: charcot-leyden crystal protein - pcmbs complex

SCOP Domain Sequences for d1hdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdka_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsyl

SCOP Domain Coordinates for d1hdka_:

Click to download the PDB-style file with coordinates for d1hdka_.
(The format of our PDB-style files is described here.)

Timeline for d1hdka_: