Class b: All beta proteins [48724] (141 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries) |
Domain d1hdka_: 1hdk A: [65807] complexed with pmb |
PDB Entry: 1hdk (more details), 1.8 Å
SCOP Domain Sequences for d1hdka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdka_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)} sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav kmvqvwrdisltkfnvsyl
Timeline for d1hdka_: