Lineage for d1hdhb_ (1hdh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138582Protein Arylsulfatase B (4-sulfatase) [53656] (2 species)
  7. 2138585Species Pseudomonas aeruginosa [TaxId:287] [69591] (1 PDB entry)
  8. 2138587Domain d1hdhb_: 1hdh B: [65806]
    complexed with ca, so4

Details for d1hdhb_

PDB Entry: 1hdh (more details), 1.3 Å

PDB Description: arylsulfatase from pseudomonas aeruginosa
PDB Compounds: (B:) arylsulfatase

SCOPe Domain Sequences for d1hdhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdhb_ c.76.1.2 (B:) Arylsulfatase B (4-sulfatase) {Pseudomonas aeruginosa [TaxId: 287]}
krpnflvivaddlgfsdigafggeiatpnldalaiaglrltdfhtastxsptrsmlltgt
dhhiagigtmaealtpelegkpgyeghlnervvalpellreagyqtlmagkwhlglkpeq
tphargfersfsllpgaanhygfeppydestprilkgtpalyvederyldtlpegfyssd
afgdkllqylkerdqsrpffaylpfsaphwplqapreivekyrgrydagpealrqerlar
lkelglveadveahpvlaltrewealedeeraksaramevyaamvermdwnigrvvdylr
rqgeldntfvlfmsdngaegalleafpkfgpdllgfldrhydnslenigransyvwygpr
waqaatapsrlykafttqggirvpalvryprlsrqgaishafatvmdvtptlldlagvrh
pgkrwrgreiaeprgrswlgwlsgeteaahdentvtgwelfgmrairqgdwkavylpapv
gpatwqlydlardpgeihdladsqpgklaeliehwkryvsetgvv

SCOPe Domain Coordinates for d1hdhb_:

Click to download the PDB-style file with coordinates for d1hdhb_.
(The format of our PDB-style files is described here.)

Timeline for d1hdhb_: