Lineage for d1hd3a_ (1hd3 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109373Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 109374Species Chicken (Gallus gallus) [TaxId:9031] [50059] (10 PDB entries)
  8. 109379Domain d1hd3a_: 1hd3 A: [65802]

Details for d1hd3a_

PDB Entry: 1hd3 (more details), 1.98 Å

PDB Description: a-spectrin sh3 domain f52y mutant

SCOP Domain Sequences for d1hd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hd3a_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgyvpaayvkkld

SCOP Domain Coordinates for d1hd3a_:

Click to download the PDB-style file with coordinates for d1hd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hd3a_: