SCOP 1.59: Domain d1hcxb_: 1hcx B:

Lineage for d1hcxb_ (1hcx B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)

4. Superfamily b.109.1: Choline binding domain of autolysin C-LytA [69360] (1 family)

5. Family b.109.1.1: Choline binding domain of autolysin C-LytA [69361] (1 protein)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein Choline binding domain of autolysin C-LytA [69362] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [69363] (2 PDB entries)

8. Domain d1hcxb_: 1hcx B: [65801]

Details for d1hcxb_

PDB Entry: 1hcx, 2.6 Å

PDB Description: choline binding domain of the major autolysin (c-lyta) from streptococcus pneumoniae

SCOP Domain Sequences for d1hcxb_:

Sequence; same for both SEQRES and ATOM records:

>d1hcxb_ b.109.1.1 (B:) Choline binding domain of autolysin C-LytA {Streptococcus pneumoniae}
gsypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyf
neegamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvep
dglitvk

Timeline for d1hcxb_:

• d1hcxb_ is new in SCOP 1.59
  
• d1hcxb_ appears in SCOP 1.61
  
• d1hcxb_ appears in the current release, SCOPe 2.08