Lineage for d1hcuc_ (1hcu C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004349Species Trichoderma reesei [TaxId:51453] [69087] (1 PDB entry)
  8. 2004352Domain d1hcuc_: 1hcu C: [65798]
    complexed with ca, nag

Details for d1hcuc_

PDB Entry: 1hcu (more details), 2.37 Å

PDB Description: alpha-1,2-mannosidase from trichoderma reesei
PDB Compounds: (C:) alpha-1,2-mannosidase

SCOPe Domain Sequences for d1hcuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcuc_ a.102.2.1 (C:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]}
gspnptraaavkaafqtswnayhhfafphddlhpvsnsfdderngwgssaidgldtailm
gdadivntilqyvpqinftttavanqgssvfetnirylggllsaydllrgpfsslatnqt
lvnsllrqaqtlanglkvafttpsgvpdptvffnptvrrsgassnnvaeigslvlewtrl
sdltgnpqyaqlaqkgesyllnpkgspeawpgligtfvstsngtfqdssgswsglmdsfy
eylikmylydpvafahykdrwvlgadstighlgshpstrkdltflssyngqstspnsghl
asfgggnfilggillneqkyidfgiklassyfgtytqtasgigpegfawvdsvtgaggsp
pssqsgfyssagfwvtapyyilrpetleslyyayrvtgdskwqdlawealsaiedacrag
sayssindvtqangggasddmesfwfaealkyaylifaeesdvqvqatggnkfvfnteah
pfsir

SCOPe Domain Coordinates for d1hcuc_:

Click to download the PDB-style file with coordinates for d1hcuc_.
(The format of our PDB-style files is described here.)

Timeline for d1hcuc_: