Lineage for d1hcfy_ (1hcf Y:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109354Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1109627Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 1109628Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)
  8. 1109631Domain d1hcfy_: 1hcf Y: [65791]
    Other proteins in same PDB: d1hcfa_, d1hcfb_
    complexed with so4

Details for d1hcfy_

PDB Entry: 1hcf (more details), 2.7 Å

PDB Description: crystal structure of trkb-d5 bound to neurotrophin-4/5
PDB Compounds: (Y:) bdnf/nt-3 growth factors receptor

SCOPe Domain Sequences for d1hcfy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcfy_ b.1.1.4 (Y:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]}
shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpg

SCOPe Domain Coordinates for d1hcfy_:

Click to download the PDB-style file with coordinates for d1hcfy_.
(The format of our PDB-style files is described here.)

Timeline for d1hcfy_: