Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (38 proteins) |
Protein Ligand binding domain of trkB receptor [49192] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries) |
Domain d1hcfy_: 1hcf Y: [65791] Other proteins in same PDB: d1hcfa_, d1hcfb_ complexed with so4 |
PDB Entry: 1hcf (more details), 2.7 Å
SCOP Domain Sequences for d1hcfy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcfy_ b.1.1.4 (Y:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey hgclqldnpthmnngdytliakneygkdekqisahfmgwpg
Timeline for d1hcfy_: