SCOP 1.75: Domain d1hcfy_: 1hcf Y:

Lineage for d1hcfy_ (1hcf Y:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Ligand binding domain of trkB receptor [49192] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)

8. Domain d1hcfy_: 1hcf Y: [65791]
   Other proteins in same PDB: d1hcfa_, d1hcfb_
   complexed with so4

Details for d1hcfy_

PDB Entry: 1hcf, 2.7 Å

PDB Description: crystal structure of trkb-d5 bound to neurotrophin-4/5

PDB Compounds: (Y:) bdnf/nt-3 growth factors receptor

SCOP Domain Sequences for d1hcfy_:

Sequence; same for both SEQRES and ATOM records:

>d1hcfy_ b.1.1.4 (Y:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]}
shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpg

Timeline for d1hcfy_:

• d1hcfy_ first appeared in SCOP 1.59
  
• d1hcfy_ appears in SCOP 1.73
  
• d1hcfy_ appears in SCOPe 2.01
  
• d1hcfy_ appears in the current release, SCOPe 2.08