Lineage for d1hcfx_ (1hcf X:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031809Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 2031810Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)
  8. 2031812Domain d1hcfx_: 1hcf X: [65790]
    Other proteins in same PDB: d1hcfa_, d1hcfb_
    complexed with so4

Details for d1hcfx_

PDB Entry: 1hcf (more details), 2.7 Å

PDB Description: crystal structure of trkb-d5 bound to neurotrophin-4/5
PDB Compounds: (X:) bdnf/nt-3 growth factors receptor

SCOPe Domain Sequences for d1hcfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcfx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]}
shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpg

SCOPe Domain Coordinates for d1hcfx_:

Click to download the PDB-style file with coordinates for d1hcfx_.
(The format of our PDB-style files is described here.)

Timeline for d1hcfx_: