Lineage for d1hcfx_ (1hcf X:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787327Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 787328Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)
  8. 787330Domain d1hcfx_: 1hcf X: [65790]
    Other proteins in same PDB: d1hcfa_, d1hcfb_

Details for d1hcfx_

PDB Entry: 1hcf (more details), 2.7 Å

PDB Description: crystal structure of trkb-d5 bound to neurotrophin-4/5
PDB Compounds: (X:) bdnf/nt-3 growth factors receptor

SCOP Domain Sequences for d1hcfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcfx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]}
shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpg

SCOP Domain Coordinates for d1hcfx_:

Click to download the PDB-style file with coordinates for d1hcfx_.
(The format of our PDB-style files is described here.)

Timeline for d1hcfx_: