SCOP 1.69: Domain d1hcfx_: 1hcf X:

Lineage for d1hcfx_ (1hcf X:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Ligand binding domain of trkB receptor [49192] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)

8. Domain d1hcfx_: 1hcf X: [65790]
   Other proteins in same PDB: d1hcfa_, d1hcfb_

Details for d1hcfx_

PDB Entry: 1hcf, 2.7 Å

PDB Description: crystal structure of trkb-d5 bound to neurotrophin-4/5

SCOP Domain Sequences for d1hcfx_:

Sequence; same for both SEQRES and ATOM records:

>d1hcfx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens)}
shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpg

Timeline for d1hcfx_:

• d1hcfx_ first appeared in SCOP 1.59
  
• d1hcfx_ appears in SCOP 1.67
  
• d1hcfx_ appears in SCOP 1.71
  
• d1hcfx_ appears in the current release, SCOPe 2.08