SCOPe 2.05: Domain d1hbja_: 1hbj A:

Lineage for d1hbja_ (1hbj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
   automatically mapped to Pfam PF00135

6. Protein Acetylcholinesterase [53476] (5 species)

7. Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (79 PDB entries)
   Uniprot P04058 25-556

8. Domain d1hbja_: 1hbj A: [65785]
   complexed with fbq, mes, nag, pg4

Details for d1hbja_

PDB Entry: 1hbj, 2.5 Å

PDB Description: x-ray crystal structure of complex between torpedo californica ache and a reversible inhibitor, 4-amino-5-fluoro-2-methyl-3-(3- trifluoroacetylbenzylthiomethyl)quinoline

PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d1hbja_:

Sequence; same for both SEQRES and ATOM records:

>d1hbja_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Timeline for d1hbja_:

• d1hbja_ first appeared in SCOP 1.59
  
• d1hbja_ appears in SCOPe 2.04
  
• d1hbja_ appears in SCOPe 2.06
  
• d1hbja_ appears in the current release, SCOPe 2.08