SCOPe 2.03: Domain d1hb5e_: 1hb5 E:

Lineage for d1hb5e_ (1hb5 E:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein p3 shell [69996] (1 species)

7. Species Bacteriophage PRD1 [TaxId:10658] [69997] (5 PDB entries)

8. Domain d1hb5e_: 1hb5 E: [65756]

Details for d1hb5e_

PDB Entry: 1hb5, 12 Å

PDB Description: quasi-atomic resolution model of bacteriophage prd1 p3-shell, obtained by combined cryo-em and x-ray crystallography.

PDB Compounds: (E:) bacteriophage prd1 p3-shell

SCOPe Domain Sequences for d1hb5e_:

Sequence; same for both SEQRES and ATOM records:

>d1hb5e_ i.6.1.1 (E:) p3 shell {Bacteriophage PRD1 [TaxId: 10658]}
qqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflv
kvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapfl
ssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskq
rlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilp
lidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrt
anfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqn
arllmgyeyftsrt

Timeline for d1hb5e_:

• d1hb5e_ first appeared in SCOP 1.59
  
• d1hb5e_ appears in SCOPe 2.02
  
• d1hb5e_ appears in SCOPe 2.04
  
• d1hb5e_ appears in the current release, SCOPe 2.08