SCOP 1.71: Domain d1hb4a_: 1hb4 A:

Lineage for d1hb4a_ (1hb4 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (1 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (15 PDB entries)

8. Domain d1hb4a_: 1hb4 A: [65751]
   complexed with fe2, scv, so4

Details for d1hb4a_

PDB Entry: 1hb4, 1.5 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (oxygen exposed product from anaerobic acov fe complex)

SCOP Domain Sequences for d1hb4a_:

Sequence; same for both SEQRES and ATOM records:

>d1hb4a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d1hb4a_:

• d1hb4a_ first appeared in SCOP 1.59
  
• d1hb4a_ appears in SCOP 1.69
  
• d1hb4a_ appears in SCOP 1.73
  
• d1hb4a_ appears in the current release, SCOPe 2.08