Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein Isopenicillin N synthase [51199] (3 species) |
Species Emericella nidulans [TaxId:162425] [51200] (27 PDB entries) Uniprot P05326 |
Domain d1hb1a_: 1hb1 A: [65748] complexed with fe2, ocv, so4 |
PDB Entry: 1hb1 (more details), 1.55 Å
SCOPe Domain Sequences for d1hb1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hb1a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]} vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn gksdreplsygdylqnglvslinkngqt
Timeline for d1hb1a_: