SCOP 1.73: Domain d1hb1a_: 1hb1 A:

Lineage for d1hb1a_ (1hb1 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (1 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (25 PDB entries)

8. Domain d1hb1a_: 1hb1 A: [65748]
   complexed with fe2, ocv, so4

Details for d1hb1a_

PDB Entry: 1hb1, 1.55 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (anaerobic acov fe complex)

PDB Compounds: (A:) isopenicillin n synthase

SCOP Domain Sequences for d1hb1a_:

Sequence; same for both SEQRES and ATOM records:

>d1hb1a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

Timeline for d1hb1a_:

• d1hb1a_ first appeared in SCOP 1.59
  
• d1hb1a_ appears in SCOP 1.71
  
• d1hb1a_ appears in SCOP 1.75
  
• d1hb1a_ appears in the current release, SCOPe 2.08