Lineage for d1ha4b_ (1ha4 B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107715Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
  4. 107716Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 107717Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 107740Protein gamma-Crystallin [49697] (5 species)
  7. 107764Species Human (Homo sapiens) [TaxId:9606] [69202] (1 PDB entry)
  8. 107766Domain d1ha4b_: 1ha4 B: [65746]

Details for d1ha4b_

PDB Entry: 1ha4 (more details), 2.4 Å

PDB Description: gammas crystallin c terminal domain from homo sapiens

SCOP Domain Sequences for d1ha4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha4b_ b.11.1.1 (B:) gamma-Crystallin {Human (Homo sapiens)}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

SCOP Domain Coordinates for d1ha4b_:

Click to download the PDB-style file with coordinates for d1ha4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ha4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ha4a_