Lineage for d1ha4a_ (1ha4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773504Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2773534Species Human (Homo sapiens) [TaxId:9606] [69202] (1 PDB entry)
  8. 2773535Domain d1ha4a_: 1ha4 A: [65745]
    C-terminal domain only

Details for d1ha4a_

PDB Entry: 1ha4 (more details), 2.4 Å

PDB Description: gammas crystallin c terminal domain from homo sapiens
PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d1ha4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha4a_ b.11.1.1 (A:) gamma-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

SCOPe Domain Coordinates for d1ha4a_:

Click to download the PDB-style file with coordinates for d1ha4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ha4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ha4b_