Lineage for d1h98a_ (1h98 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192689Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2192690Protein Ferredoxin [54871] (3 species)
  7. 2192736Species Thermus thermophilus [TaxId:274] [69725] (1 PDB entry)
  8. 2192737Domain d1h98a_: 1h98 A: [65743]
    complexed with f3s, sf4

Details for d1h98a_

PDB Entry: 1h98 (more details), 1.64 Å

PDB Description: new insights into thermostability of bacterial ferredoxins: high resolution crystal structure of the seven-iron ferredoxin from thermus thermophilus
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1h98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}
phvicepcigvkdqscvevcpveciydggdqfyihpeecidcgacvpacpvnaiypeedv
peqwksyieknrklagl

SCOPe Domain Coordinates for d1h98a_:

Click to download the PDB-style file with coordinates for d1h98a_.
(The format of our PDB-style files is described here.)

Timeline for d1h98a_: