![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein Ferredoxin [54871] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [69725] (1 PDB entry) |
![]() | Domain d1h98a_: 1h98 A: [65743] complexed with f3s, sf4 |
PDB Entry: 1h98 (more details), 1.64 Å
SCOPe Domain Sequences for d1h98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} phvicepcigvkdqscvevcpveciydggdqfyihpeecidcgacvpacpvnaiypeedv peqwksyieknrklagl
Timeline for d1h98a_: