SCOP 1.71: Domain d1h8la1: 1h8l A:305-383

Lineage for d1h8la1 (1h8l A:305-383)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain [49464] (1 family)

5. Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins)

6. Protein Carboxypeptidase D C-terminal domain [49466] (1 species)

7. Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (2 PDB entries)

8. Domain d1h8la1: 1h8l A:305-383 [65737]
   Other proteins in same PDB: d1h8la2
   complexed with gem, man, nag, so4, zn

Details for d1h8la1

PDB Entry: 1h8l, 2.6 Å

PDB Description: duck carboxypeptidase d domain ii in complex with gemsa

SCOP Domain Sequences for d1h8la1:

Sequence; same for both SEQRES and ATOM records:

>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides)}
giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk
tvevdskggvqvnftlsrt

Timeline for d1h8la1:

• d1h8la1 first appeared in SCOP 1.59
  
• d1h8la1 appears in SCOP 1.69
  
• d1h8la1 appears in SCOP 1.73
  
• d1h8la1 appears in the current release, SCOPe 2.08