Class b: All beta proteins [48724] (180 folds) |
Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) |
Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
Protein Choline binding domain of autolysin C-LytA [69362] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69363] (4 PDB entries) |
Domain d1h8ga_: 1h8g A: [65735] complexed with cht |
PDB Entry: 1h8g (more details), 2.4 Å
SCOPe Domain Sequences for d1h8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ga_ b.109.1.1 (A:) Choline binding domain of autolysin C-LytA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tdgnwywfdnsgematgwkkiadkwyyfneegamktgwvkykdtwyyldakegamvsnaf iqsadgtgwyylkpdgtladrpeftvepdglitvk
Timeline for d1h8ga_: