Lineage for d1h8ac2 (1h8a C:144-191)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634507Family a.4.1.3: Myb/SANT domain [46739] (13 proteins)
  6. 634569Protein v-Myb [68960] (1 species)
  7. 634570Species Avian myeloblastosis virus [TaxId:11866] [68961] (1 PDB entry)
  8. 634572Domain d1h8ac2: 1h8a C:144-191 [65732]
    Other proteins in same PDB: d1h8aa_, d1h8ab_
    repeats 2 & 3

Details for d1h8ac2

PDB Entry: 1h8a (more details), 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3
PDB Compounds: (C:) myb transforming protein

SCOP Domain Sequences for d1h8ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ac2 a.4.1.3 (C:144-191) v-Myb {Avian myeloblastosis virus [TaxId: 11866]}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnavknhwnstmrr

SCOP Domain Coordinates for d1h8ac2:

Click to download the PDB-style file with coordinates for d1h8ac2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ac2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8ac1